Serving Australia and NZ
1300 543 373
Loading...

Recombinant Human Angiotensin-converting enzyme 2(ACE2),partial

Recombinant Human Angiotensin-converting enzyme 2(ACE2),partial

Quick Overview:

Product Code: CSB-AP005671HU
Supplier: Cusabio

Details
Recombinant proteins Partial Gene: ACE2 Uniprot: Q9BYF1
Additional Information
Product Name Recombinant Human Angiotensin-converting enzyme 2(ACE2),partial
Supplier name Cusabio
Concentration Lyophilized powder
Construction 18-740aa QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLP
Source Human
Biological Activity Specific activity as determined by its ability to cleave a fluorogenic peptide substrate, Mca-YVADAPK(Dnp)-OH is greater than 800 pmol/min/μg.
Size 10ug
Endotoxin level Less than 1.0 EU/µg as determined by LAL method.
Molecular Weight 84.63 kDa
Purity Greater than 95% as determined by SDS-PAGE.
Species Reactivity Human
Applications WB
Storage/Storage buffer 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, 0.1 mM ZnCl2, 10% Glycerol, pH 7.5
Form Lyophilized powder
Product Type Proteins
Expression Mammalian cell
Purification Affinity purified
Aliases Angiotensin-Converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2
Datasheet URL View Datasheet
Target/Antigen ACE2
Publications Publication List

Images