Serving Australia and NZ
1300 543 373

Immunoassays

Loading...

Items 1-30 of 3619

Set Descending Direction
Page
per page

Product Name

Product Number

Supplier

Size

Melanocyte Associated Antigen gp100 (AA: Ala-Leu-Asn-Phe-Pro-Gly-Ser-Gln-Lys) (MW: 9619) SP-100509-5 Alpha Diagnostic 5 mg
VA - ß - MSH, Lipotropin - ¿, Proopiomelanocortin ? derived (AA: Val-Ala-Ala-Glu-Lys-Lys-Asp-Glu-Gly-Pro-Tyr-Arg-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp) (MW: 2831.19) SP-100510-1 Alpha Diagnostic 1 mg
ß-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) SP-100511-1 Alpha Diagnostic 1 mg
Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and Cys 9-29 )) (MW: 3442.1) SP-100512-1 Alpha Diagnostic 1 mg
[D-Arg6] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MW: 1603.98] SP-100514-5 Alpha Diagnostic 5 mg
[D-Arg8] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MW: 16471] SP-100515-5 Alpha Diagnostic 5 mg
Biotin-Dynorphin A (1-17) (AA: Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln) (MW: 2373.83) SP-100516-1 Alpha Diagnostic 1 mg
Dynorphin A (2 - 13), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys) (MW: 1440.81) SP-100518-5 Alpha Diagnostic 5 mg
Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (AA: Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys13-Cys29) (MW: 3910.64) SP-100519-1 Alpha Diagnostic 1 mg
Atrial Natriuretic Factor (1-24) (frog) (AA: Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (MW: 2561.87)_x000D_ (Disulfide bridge:Cys4-Cys20) (MW: 2561.87) SP-100520-05 Alpha Diagnostic 0.5 mg
Biotin-ß-Endomorphin, human (AA: Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) (MW: 3691.36) SP-100521-1 Alpha Diagnostic 1 mg
Atrial Natriuretic Factor (1-29) (chicken) (AA: Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Ile-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Met-Gly-Cys-Asn-Gly-Ser-Arg-Lys-Asn (Disulfide bridge Cys7-Cys23 )) (MW: 3160.7) SP-100522-05 Alpha Diagnostic 0.5 mg
Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr _x000D_ (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3) SP-100523-05 Alpha Diagnostic 0.5 mg
[Cys18]-Atrial Natriuretic Factor (4-18) amide (rat)[Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Cys-NH2; (Disulfide bridge:Cys7-Cys18); MW: 1594.9] SP-100524-5 Alpha Diagnostic 5 mg
Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr _x000D_ (Disulfide bridge:Cys7-Cys23 )) (MW: 27246) SP-100525-05 Alpha Diagnostic 0.5 mg
Ac-ß- Endorphin, bovine, camel, ovine [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3480.1)] SP-100526-1 Alpha Diagnostic 1 mg
Big Endothelin -1 (1-39), porcine (AA: Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser _x000D_ (Disulfide bridge: Cys1-Cys15, Cys3-Cys11)) SP-100527-1 Alpha Diagnostic 1 mg
[Tyr0]-Atriopeptin II (rat) [Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge:Cys4-Cys20 ); MW 2549.9] SP-100529-1 Alpha Diagnostic 1 mg
mini-ANP (AA:Met-Cys-His-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Ser-Cys-Tyr-Arg-NH2 _x000D_ (Disulfide bridge:Cys2-Cys13)) (MW: 1829.19) SP-100530-1 Alpha Diagnostic 1 mg
Prepro-Atrial Natriuretic Factor (26-55) (human) (AA: Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp) (MW: 3508) SP-100531-1 Alpha Diagnostic 1 mg
Prepro-Atrial Natriuretic Factor (56-92) (human) (AA: Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-Pro-Glu-Val-Pro-Pro-Trp-Thr-Gly-Glu-Val-Ser-Pro-Ala-Gln-Arg) (MW: 3878.3) SP-100532-1 Alpha Diagnostic 1 mg
Prepro-Atrial Natriuretic Factor (104-123) (human) (AA: Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg) (MW: 2183.6) SP-100533-1 Alpha Diagnostic 1 mg
[Tyr0]-Prepro-Atrial Natriuretic Factor (104-123) (human) [Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg; MW 2346.8] SP-100534-1 Alpha Diagnostic 1 mg
Locustachykinin I (AA: Gly-Pro-Ser-Gly-Phe-Tyr-Gly-Val-Arg-NH2) (MW: 938) SP-100535-5 Alpha Diagnostic 5 mg
Locustachykinin II (AA: Ala-Pro-Leu-Ser-Gly-Phe-Tyr-Gly-Val-Arg-NH2) (MW: 1065.4) SP-100536-5 Alpha Diagnostic 5 mg
SALMF amide 1 (S1) (AA: Gly-Phe-Asn-Ser-Ala-Leu-Met-Phe-NH2) (MW: 885.1) SP-100537-5 Alpha Diagnostic 5 mg
SALMF amide 2 (S2) (AA: Ser-Gly-Pro-Tyr-Ser-Phe-Asn-Ser-Gly-Leu-Thr-Phe-NH2) (MW: 1275.4 SP-100538-5 Alpha Diagnostic 5 mg
Laminin A Chain (2091-2108) (AA: Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg) (MW: 2016.3) SP-100539-1 Alpha Diagnostic 1 mg
Laminin A Chain (2091-2108) (AA: Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg) (MW: 2016.3) SP-100539-5 Alpha Diagnostic 5 mg
Leucokinin II (AA: Asp-Pro-Gly-Phe-Ser-Ser-Trp-Gly-NH2) (MW: 850.9) SP-100540-5 Alpha Diagnostic 5 mg

Items 1-30 of 3619

Set Descending Direction
Page
per page