Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 89C1(UGT89C1)

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 89C1(UGT89C1)

Quick Overview:

Product Code: CSB-EP873303DOA
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: UGT89C1 Uniprot: Q9LNE6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-435aa MTTTTTKKPHVLVIPFPQSGHMVPHLDLTHQILLRGATVTVLVTPKNSSYLDALRSLHSPEHFKTLILPFPSHPCIPSGVESLQQLPLEAIVHMFDALSRLHDPLVDFLSRQPPSDLPDAILGSSFLSPWINKVADAFSIKSISFLPINAHSISVMWAQEDRSFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGGQSSIPPAKVSAWLDSCPEDNSVVYVG
    Source Arabidopsis thaliana
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 51.6 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen UGT89C1
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Flavonol 7-O-rhamnosyltransferase UDP-rhamnose: flavonol 7-O-rhamnosyltransferase
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images