Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)

Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)

Quick Overview:

Product Code: CSB-EP836318APO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: eglD Uniprot: Q96WQ9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 21-408aa HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAA
    Source Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 45.2 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen eglD
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images