Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Bovine C-C motif chemokine 20(CCL20)

Recombinant Bovine C-C motif chemokine 20(CCL20)

Quick Overview:

Product Code: CSB-EP840478BO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: CCL20 Uniprot: Q8SQB1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 27-96aa ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM
    Source Bovine
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 24.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CCL20
    Species Reactivity Bovine
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Macrophage inflammatory protein 3 alpha ;MIP-3-alpha;Small-inducible cytokine A20
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images