Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Bovine Lingual antimicrobial peptide(LAP3),partial

Recombinant Bovine Lingual antimicrobial peptide(LAP3),partial

Quick Overview:

Product Code: CSB-EP632987BO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: LAP3 Uniprot: P00727
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 25-64aa PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS
    Source Bovine
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 20.3 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen LAP3
    Species Reactivity Bovine
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Leucine aminopeptidase 3 ;LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images