Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Bovine Odorant-binding protein

Recombinant Bovine Odorant-binding protein

Quick Overview:

Product Code: CSB-MP362133BO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: N/A Uniprot: P07435
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-159aa AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
    Source Bovine
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 22 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Species Reactivity Bovine
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Olfactory mucosa pyrazine-binding protein
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images