Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Candida glabrata Autophagy-related protein 8(ATG8)

Recombinant Candida glabrata Autophagy-related protein 8(ATG8)

Quick Overview:

Product Code: CSB-EP739788CZIa2
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: ATG8 Uniprot: Q6FXR8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-116aa MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG
    Source Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 29.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ATG8
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Autophagy-related ubiquitin-like modifier ATG8
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images