Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Colwellia psychrerythraea DNA ligase(ligA),partial

Recombinant Colwellia psychrerythraea DNA ligase(ligA),partial

Quick Overview:

Product Code: CSB-EP669648CBAB
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ligA Uniprot: Q47YI0
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 330-689aa KFPAEEELTCVEDVEFQVGRTGAITPVARLKPVFVGGVTVSNATLHNQDEITRLGLKVNDFVVIRRAGDVIPQIVSVVLDKRPDNAVDIVFPTSCPVCDSAVAKPEGEAVLRCTAGLFCAAQRKEAIKHFASRKAHDVDGLGDKLVEQLVDEKLINTPADLFKLTEIQVSTIDRMGKKSATNLINGLEQAKSTTLAKFIYGLGIREVGEATAANLANHFYTLAAIESASLEDLQNVSDVGEVVAK
    Source Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 42.1 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen ligA
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Polydeoxyribonucleotide synthase [NAD(+)]
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images