Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Cricetulus griseus Sialidase-2 (NEU2)

Recombinant Cricetulus griseus Sialidase-2 (NEU2)

Quick Overview:

Product Code: CSB-MP734101DXU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: NEU2 Uniprot: Q64393
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-379aa MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQ
    Source Chinese hamster
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 47 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen NEU2
    Species Reactivity Hamster
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Cytosolic sialidase (N-acetyl-alpha-neuraminidase 2 )
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images