Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Ctenocephalides felis Salivary antigen 1

Recombinant Ctenocephalides felis Salivary antigen 1

Quick Overview:

Product Code: CSB-EP835981CTP
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: N/A Uniprot: Q94424
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 19-176aa EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK
    Source Cat flea
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 34.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images