Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Dog Interleukin-8(IL8)

Recombinant Dog Interleukin-8(IL8)

Quick Overview:

Product Code: CSB-MP011671DO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: IL-8 Uniprot: P41324
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 23-101aa AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
    Source Dog
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 13.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen IL-8
    Species Reactivity Dog
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images