Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

Quick Overview:

Product Code: CSB-EP624920EEZ1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: LMP1 Uniprot: Q1HVB3
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 185-371aa YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
    Source Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 24.3 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen LMP1
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Protein p63
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images