Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

Quick Overview:

Product Code: CSB-EP633459EGW
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: dnaK Uniprot: Q1RGI8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-638aa MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKD
    Source Escherichia coli (strain UTI89 / UPEC)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 73.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen dnaK
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases HSP70 Heat shock 70KDA protein Heat shock protein 70
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images