Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)

Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)

Quick Overview:

Product Code: CSB-MP317177ENV
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: insE1 Uniprot: P0CF66
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-99aa MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
    Source Escherichia coli (strain K12)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 37.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen insE1
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images