Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Hepatitis B virus genotype D subtype ayw Protein X(X)

Recombinant Hepatitis B virus genotype D subtype ayw Protein X(X)

Quick Overview:

Product Code: CSB-EP865559HEO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: X Uniprot: Q9QMI3
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-154aa MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
    Source Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 32.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen X
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases HBx Peptide X pX
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images