Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human 17-beta-hydroxysteroid dehydrogenase 14(HSD17B14)

Recombinant Human 17-beta-hydroxysteroid dehydrogenase 14(HSD17B14)

Quick Overview:

Product Code: CSB-EP859026HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: HSD17B14 Uniprot: Q9BPX1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-270aa MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 44.3 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen HSD17B14
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 17-beta-hydroxysteroid dehydrogenase DHRS10Dehydrogenase/reductase SDR family member 10Retinal short-chain dehydrogenase/reductase retSDR3Short chain dehydrogenase/reductase family 47C member 1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images