Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2(HSD17B10)

Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2(HSD17B10)

Quick Overview:

Product Code: CSB-EP860776HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: HSD17B10 Uniprot: Q99714
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-261aa AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 42.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen HSD17B10
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 17-beta-hydroxysteroid dehydrogenase 10 (EC:1.1.1.51) ;17-beta-HSD 103-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC:1.1.1.178)3-hydroxyacyl-CoA dehydrogenase type IIEndoplasmic reticulum-associated amyloid beta-peptide-binding protein;Mitochondrial ribon
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images