Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2)

Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2)

Quick Overview:

Product Code: CSB-YP001118HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: ACAA2 Uniprot: P42765
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression Yeast
    Construction 17-397aa FGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVII
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 42.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ACAA2
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Acetyl-CoA acyltrans feraseBeta-ketothiolase;Mitochondrial 3-oxoacyl-CoA thiolaseT1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images