Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human 40S ribosomal protein S10(RPS10),partial

Recombinant Human 40S ribosomal protein S10(RPS10),partial

Quick Overview:

Product Code: CSB-RP025654h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: RPS10 Uniprot: P46783
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 4-165aa PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 45.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen RPS10
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images