Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Acidic mammalian chitinase(CHIA)

Recombinant Human Acidic mammalian chitinase(CHIA)

Quick Overview:

Product Code: CSB-EP874858HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Isoform 2 Gene: CHIA Uniprot: Q9BZP6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-368aa MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 67.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CHIA
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Lung-specific protein TSA1902
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images