Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Actin-related protein 2/3 complex subunit 3(ARPC3),partial

Recombinant Human Actin-related protein 2/3 complex subunit 3(ARPC3),partial

Quick Overview:

Product Code: CSB-RP033244h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ARPC3 Uniprot: O15145
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-175aa PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 47.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ARPC3
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Arp2/3 complex 21KDA subunit ;p21-AR;C
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images