Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Ankyrin repeat and SOCS box protein 6(ASB6)

Recombinant Human Ankyrin repeat and SOCS box protein 6(ASB6)

Quick Overview:

Product Code: CSB-EP868341HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Isoform 2 Gene: ASB6 Uniprot: Q9NWX5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-197aa MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 38.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ASB6
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images