Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Annexin A5(ANXA5)

Recombinant Human Annexin A5(ANXA5)

Quick Overview:

Product Code: CSB-YP001846HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: ANXA5 Uniprot: P08758
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression Yeast
    Construction 2-320aa AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIP
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 37.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ANXA5
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Anchorin CII;Annexin V;Annexin-5;Calphobindin I ;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4 ;PP4Placental anticoagulant protein I ;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha ;VAC-alpha
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images