Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Annexin A6(ANXA6),partial

Recombinant Human Annexin A6(ANXA6),partial

Quick Overview:

Product Code: CSB-RP007944h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ANX6 Uniprot: P08133
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-245aa AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 54.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ANX6
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 67KDA calelectrin;Annexin VIAnnexin-6Calphobindin-II ;CPB-IIChromobindin-20Lipocortin VIProtein IIIp68p70
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images