Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human AP-2 complex subunit mu(AP2M1)

Recombinant Human AP-2 complex subunit mu(AP2M1)

Quick Overview:

Product Code: CSB-YP001872HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: AP2M1 Uniprot: Q96CW1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression Yeast
    Construction 1-435aa MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCT
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 51.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen AP2M1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases AP-2 mu chain;Adaptin-mu2Adaptor protein complex AP-2 subunit muAdaptor-related protein complex 2 subunit muClathrin assembly protein complex 2 mu medium chain;Clathrin coat assembly protein AP50Clathrin coat-associated protein AP50HA2 50KDA subunitPlasma
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images