Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B)

Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B)

Quick Overview:

Product Code: CSB-EP892352HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: DDX19B Uniprot: Q9UMR2
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-479aa ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMI
    Source Human
    Biological Activity Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 μg/ml.
    Endotoxin level Not Tested
    Molecular Weight 80.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen DDX19B
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5, DDX19, TDBP
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images