Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human B-cell receptor CD22(CD22),partial

Recombinant Human B-cell receptor CD22(CD22),partial

Quick Overview:

Product Code: CSB-MP004900HU
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: CD22 Uniprot: P20273
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 20-687aa DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTC
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 79.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CD22
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases B-lymphocyte cell adhesion molecule (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD22) (SIGLEC2)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images