Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Bifunctional polynucleotide phosphatase/kinase(PNKP)

Recombinant Human Bifunctional polynucleotide phosphatase/kinase(PNKP)

Quick Overview:

Product Code: CSB-EP857031HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: PNKP Uniprot: Q96T60
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-521aa MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPF
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 73.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen PNKP
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DNA 5'-kinase/3'-phosphatasePolynucleotide kinase-3'-phosphatase 2 domains:Polynucleotide 3'-phosphatase (EC:3.1.3.32) ;2'(3')-polynucleotidasePolynucleotide 5'-hydroxyl-kinase (EC:2.7.1.78)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images