Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Bis(5'-adenosyl)-triphosphatase(FHIT)

Recombinant Human Bis(5'-adenosyl)-triphosphatase(FHIT)

Quick Overview:

Product Code: CSB-RP115474h
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: FHIT Uniprot: P49789
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-147aa SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 20.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen FHIT
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases AP3A hydrolase ;AP3AaseDiadenosine 5',5'''-P1,P3-triphosphate hydrolaseDinucleosidetriphosphataseFragile histidine triad protein
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images