Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human C-C motif chemokine 5(CCL5)

Recombinant Human C-C motif chemokine 5(CCL5)

Quick Overview:

Product Code: CSB-RP059574h
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: CCL5 Uniprot: P13501
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 24-91aa SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 11.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CCL5
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases EoCPEosinophil chemotactic cytokine;SIS-delta;Small-inducible cytokine A5T cell-specific protein P228 ;TCP228T-cell-specific protein RANTES
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images