Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial

Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial

Quick Overview:

Product Code: CSB-MP855470HU
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: CLEC4C Uniprot: Q8WTT0
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 45-213aa NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 24 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CLEC4C
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Blood dendritic cell antigen 2 Short name: BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen: CD303
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images