Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

Quick Overview:

Product Code: CSB-RP010974h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: CHD4 Uniprot: Q14839
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-239aa MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 31.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CHD4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images