Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase(ST8SIA4)

Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase(ST8SIA4)

Quick Overview:

Product Code: CSB-EP821630HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Isoform 2 Gene: ST8SIA4 Uniprot: Q92187
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 21-168aa KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 32.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ST8SIA4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Alpha-2,8-sialyltransferase 8DPolysialyltransferase-1Sialyltransferase 8D ;SIAT8-DSialyltransferase St8Sia IV ;ST8SiaIV
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images