Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human cytomegalovirus Cytoplasmic envelopment protein 3(UL99)

Recombinant Human cytomegalovirus Cytoplasmic envelopment protein 3(UL99)

Quick Overview:

Product Code: CSB-RP183074Ba
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: UL99 Uniprot: P13200
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-190aa GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF
    Source Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 24.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen UL99
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 28KDA structural phosphoprotein pp28
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images