Serving Australia and NZ
1300 543 373
Loading...

Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Quick Overview:

Product Code: CSB-RP032554h
Supplier: Cusabio

Details
Recombinant proteins Partial Gene: PHGDH Uniprot: O43175
Additional Information
Product Name Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial
Supplier name Cusabio
Concentration 0.1-2.0mg/ml
Construction 2-251aa AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRA
Source Human
Biological Activity Not Tested
Size 100ug
Endotoxin level Not Tested
Molecular Weight 53.8 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Species Reactivity Human
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression E.coli
Purification Affinity purified
Datasheet URL View Datasheet
Target/Antigen PHGDH
Publications Publication List

Images