Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Deoxyribonuclease gamma(DNASE1L3)

Recombinant Human Deoxyribonuclease gamma(DNASE1L3)

Quick Overview:

Product Code: CSB-EP621686HUe1
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: DNASE1L3 Uniprot: Q13609
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 21-305aa MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 33.4 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen DNASE1L3
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD) (DNase gamma) (DHP2) (DNAS1L3)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images