Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC2(POLR1D)

Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC2(POLR1D)

Quick Overview:

Product Code: CSB-EP897095HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: POLR1D Uniprot: Q9Y2S0
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-133aa MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 42.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen POLR1D
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases AC19 DNA-directed RNA polymerase I subunit D RNA polymerase I 16KDA subunit
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images