Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Dual specificity protein phosphatase 13 isoform MDSP(DUSP13)

Recombinant Human Dual specificity protein phosphatase 13 isoform MDSP(DUSP13)

Quick Overview:

Product Code: CSB-EP734923HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: DUSP13 Uniprot: Q6B8I1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-198aa MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 36.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen DUSP13
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Branching-enzyme interacting DSPMuscle-restricted DSP ;MDSP
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images