Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human E3 ubiquitin-protein ligase MIB1(MIB1) ,partial

Recombinant Human E3 ubiquitin-protein ligase MIB1(MIB1) ,partial

Quick Overview:

Product Code: CSB-RP132874h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: MIB1 Uniprot: Q86YT6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 5-332aa RNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 40.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MIB1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DAPK-interacting protein 1 ;DIP-1Mind bomb homolog 1Zinc finger ZZ type with ankyrin repeat domain protein 2
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images