Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Quick Overview:

Product Code: CSB-EP856932HUe0
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: PELI1 Uniprot: Q96FA3
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-418aa MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLC
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 73.0 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen PELI1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images