Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human E3 ubiquitin-protein ligase RAD18(RAD18)

Recombinant Human E3 ubiquitin-protein ligase RAD18(RAD18)

Quick Overview:

Product Code: CSB-EP889102HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: RAD18 Uniprot: Q9NS91
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-495aa MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTV
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 72.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen RAD18
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Postreplication repair protein RAD18 ;hHR18 ;hRAD18RING finger protein 73
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images