Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Estradiol 17-beta-dehydrogenase 11(HSD17B11)

Recombinant Human Estradiol 17-beta-dehydrogenase 11(HSD17B11)

Quick Overview:

Product Code: CSB-EP843318HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: HSD17B11 Uniprot: Q8NBQ5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 20-300aa ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAF
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 46.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen HSD17B11
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 17-beta-hydroxysteroid dehydrogenase 11 ;17-beta-HSD 11 ;17bHSD11 ;17betaHSD1117-beta-hydroxysteroid dehydrogenase XI ;17-beta-HSD XI ;17betaHSDXICutaneous T-cell lymphoma-associated antigen HD-CL-03 ;CTCL-associated antigen HD-CL-03Dehydrogenase/reductas
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images