Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Exonuclease V(EXO5)

Recombinant Human Exonuclease V(EXO5)

Quick Overview:

Product Code: CSB-EP863995HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: EXO5 Uniprot: Q9H790
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-373aa MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 57.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen EXO5
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Defects in morphology protein 1 homolog
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images