Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1(GABARAPL1)

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1(GABARAPL1)

Quick Overview:

Product Code: CSB-EP861986HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: GABARAPL1 Uniprot: Q9H0R8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-117aa MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 40.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen GABARAPL1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images