Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Quick Overview:

Product Code: CSB-EP618634HU1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: GRIN2A Uniprot: Q12879
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 23-555aa VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 18.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen GRIN2A
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A ;NMDAR2A ;NR2A ;hNR2A
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images