Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Glycerol-3-phosphate dehydrogenase 1-like protein(GPD1L)

Recombinant Human Glycerol-3-phosphate dehydrogenase 1-like protein(GPD1L)

Quick Overview:

Product Code: CSB-EP854029HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: GPD1L Uniprot: Q8N335
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-351aa MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFKELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIFCKG
    Source Human
    Biological Activity Measured by its binding ability in a functional ELISA. Immobilized CCL5 at 2 μg/ml can bind human GPD1L, the EC50 of human GPD1L protein is 47.34-66.33 μg/ml.
    Endotoxin level Not Tested
    Molecular Weight 65.4 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen GPD1L
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases KIAA0089
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images