Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Growth/differentiation factor 15(GDF15),partial

Recombinant Human Growth/differentiation factor 15(GDF15),partial

Quick Overview:

Product Code: CSB-EP859530HU1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: GDF15 Uniprot: Q99988
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 197-308aa ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 16.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen GDF15
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Macrophage inhibitory cytokine 1 (MIC-1) (NSAID-activated gene 1 protein) (NAG-1) (NSAID-regulated gene 1 protein) (NRG-1) (Placental TGF-beta) (Placental bone morphogenetic protein) (Prostate differentiation factor) (GDF-15)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images