Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3)

Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3)

Quick Overview:

Product Code: CSB-EP883438HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: AK3 Uniprot: Q9UIJ7
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-227aa MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 32.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen AK3
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Adenylate kinase 3 (AK 3) (Adenylate kinase 3 alpha-like 1) (AK3L1) (AK6) (AKL3L)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images