Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Quick Overview:

Product Code: CSB-MP613693HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: GUCA2B Uniprot: Q16661
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 27-112aa VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 13.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen GUCA2B
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images